| Product Number |
ARP42888_T100 |
| Product Page |
www.avivasysbio.com/ocln-antibody-n-terminal-region-arp42888-t100.html |
| Name |
OCLN Antibody - N-terminal region (ARP42888_T100) |
| Protein Size (# AA) |
522 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
4950 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Occludin |
| Alias Symbols |
BLCPMG |
| Peptide Sequence |
Synthetic peptide located within the following region: MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shen,L., (2008) J. Cell Biol. 181 (4), 683-695 |
| Description of Target |
OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OCLN (ARP42888_T100) antibody |
| Blocking Peptide |
For anti-OCLN (ARP42888_T100) antibody is Catalog # AAP42888 (Previous Catalog # AAPP11113) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human OCLN |
| Uniprot ID |
Q16625 |
| Protein Name |
Occludin |
| Protein Accession # |
NP_002529 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002538 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OCLN |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-OCLN Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T |
|
|
