PRKCZ Antibody - N-terminal region (ARP42881_P050)

• Product Number: ARP42881_P050
• Name: PRKCZ Antibody - N-terminal region (ARP42881_P050)
• Protein Size (# AA): 409 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 5590
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Protein kinase C, zeta
• Alias Symbols: PKC2, PKC-ZETA
• Peptide Sequence: Synthetic peptide located within the following region: MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Xie,Z., (2006) J. Biol. Chem. 281 (10), 6366-6375
• Description of Target: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein Interactions: MAPK7; PRKCZ; AKT2; AKT1; Sqstm1; PARD6A; NUMB; NPM1; HIST1H1B; CFL1; C1QBP; HSP90AA1; NCF1; MARCKS; PPP1R14A; HIST1H1A; UBC; VHL; LRRK2; AJUBA; PARD6B; PAWR; Smurf1; Smurf2; Pard3; HIST3H3; CD44; NCOA3; TFF1; RELA; ESR1; MBP; TRIM41; PIAS4; CCDC115; ZNF7
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRKCZ (ARP42881_P050) antibody is Catalog # AAP42881 (Previous Catalog # AAPP11581)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCZ
• Uniprot ID: Q05513
• Protein Name: Protein kinase C zeta type
• Protein Accession #: NP_001028753
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001033581
• Tested Species Reactivity: Human
• Gene Symbol: PRKCZ
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 75%; Guinea Pig: 75%; Horse: 75%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PRKCZ Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human Testis
  
  Rabbit Anti-PRKCZ Antibody
  Catalog Number: ARP42881_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
  Observed Staining: Cytoplasm
  Primary Antibody Concentration: 1:600
  Other Working Concentrations: N/A
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec