Parp8 Antibody - C-terminal region (ARP42877_P050)

Data Sheet
 
Product Number ARP42877_P050
Product Page www.avivasysbio.com/parp8-antibody-c-terminal-region-arp42877-p050.html
Name Parp8 Antibody - C-terminal region (ARP42877_P050)
Protein Size (# AA) 493 amino acids
Molecular Weight 54kDa
NCBI Gene Id 52552
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Poly (ADP-ribose) polymerase family, member 8
Alias Symbols ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik
Peptide Sequence Synthetic peptide located within the following region: LIGILTPSSSSSQPPVRKHFHLAFLHVAKGQEICLHFLIRPGRGKKQDTC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of Parp8 remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Parp8 (ARP42877_P050) antibody
Blocking Peptide For anti-Parp8 (ARP42877_P050) antibody is Catalog # AAP42877 (Previous Catalog # AAPS10907)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human Parp8
Uniprot ID Q3UD82
Protein Accession # XP_983188
Purification Affinity Purified
Nucleotide Accession # XM_978094
Tested Species Reactivity Mouse
Gene Symbol Parp8
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Thymus
WB Suggested Anti-Parp8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Mouse Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com