| Product Number |
ARP42845_T100 |
| Product Page |
www.avivasysbio.com/cldn2-antibody-n-terminal-region-arp42845-t100.html |
| Name |
CLDN2 Antibody - N-terminal region (ARP42845_T100) |
| Protein Size (# AA) |
230 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
9075 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Claudin 2 |
| Alias Symbols |
OAZON |
| Peptide Sequence |
Synthetic peptide located within the following region: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Escaffit,F., (2005) J. Cell. Physiol. 203 (1), 15-26 |
| Description of Target |
Members of the claudin protein family, such as CLDN2, are expressed in an organ-specific manner and regulate the tissue-specific physiologic properties of tight junctions.Members of the claudin protein family, such as CLDN2, are expressed in an organ-specific manner and regulate the tissue-specific physiologic properties of tight junctions (Sakaguchi et al., 2002).[supplied by OMIM]. |
| Protein Interactions |
NOTCH2NL; KRTAP10-3; KRT31; LNX1; TJP2; PIAS2; UBE2I; KRTAP4-12; WNK4; TJP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLDN2 (ARP42845_T100) antibody |
| Blocking Peptide |
For anti-CLDN2 (ARP42845_T100) antibody is Catalog # AAP42845 (Previous Catalog # AAPS10611) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CLDN2 |
| Uniprot ID |
P57739 |
| Protein Name |
Claudin-2 |
| Protein Accession # |
NP_065117 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020384 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLDN2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
| Image 1 | Human MCF7
 | Host: Rabbit
Target Name: CLDN2
Sample Tissue: Human MCF7
Antibody Dilution: 1.0ug/ml |
|
|
