| Product Number |
ARP42842_T100 |
| Product Page |
www.avivasysbio.com/anxa6-antibody-c-terminal-region-arp42842-t100.html |
| Name |
Anxa6 Antibody - C-terminal region (ARP42842_T100) |
| Protein Size (# AA) |
673 amino acids |
| Molecular Weight |
74kDa |
| NCBI Gene Id |
11749 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Annexin A6 |
| Alias Symbols |
A, An, Cab, Cam, Anx6, Cabm, Camb, AnxVI, AW107198 |
| Peptide Sequence |
Synthetic peptide located within the following region: LISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Anxa6 may associate with CD21 and may regulate the release of Ca(2+) from intracellular stores. |
| Protein Interactions |
Isg15; Kcnq3; Kcnq2; PLCB3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Anxa6 (ARP42842_T100) antibody |
| Blocking Peptide |
For anti-Anxa6 (ARP42842_T100) antibody is Catalog # AAP42842 (Previous Catalog # AAPS10608) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Anxa6 |
| Uniprot ID |
P14824 |
| Protein Name |
Annexin A6 |
| Protein Accession # |
NP_038500 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_013472 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Anxa6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse SP2/0
 | WB Suggested Anti-Anxa6 Antibody Titration: 5.0ug/ml
Positive Control: SP2/0 cell lysate |
|
|
