Anxa6 antibody - C-terminal region (ARP42842_T100)
Data Sheet
Product Number ARP42842_T100
Product Page
Product Name Anxa6 antibody - C-terminal region (ARP42842_T100)
Size 100 ul
Gene Symbol Anxa6
Alias Symbols AW107198, Anx6, AnxVI, Cabm, Camb
Protein Size (# AA) 673 amino acids
Molecular Weight 74kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 11749
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Annexin A6
Description This is a rabbit polyclonal antibody against Anxa6. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: LISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDKTSLETRFMTV
Description of Target Anxa6 may associate with CD21 and may regulate the release of Ca(2+) from intracellular stores.
Protein Interactions Isg15; Kcnq3; Kcnq2; PLCB3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-Anxa6 (ARP42842_T100) antibody is Catalog # AAP42842 (Previous Catalog # AAPS10608)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse Anxa6
Complete computational species homology data Anti-Anxa6 (ARP42842_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Anxa6.
Swissprot Id P14824
Protein Name Annexin A6
Protein Accession # NP_038500
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Anxa6.
Nucleotide Accession # NM_013472
Replacement Item This antibody may replace item sc-113205 from Santa Cruz Biotechnology.
Conjugation Options

ARP42842_T100-FITC Conjugated

ARP42842_T100-HRP Conjugated

ARP42842_T100-Biotin Conjugated

CB Replacement sc-113205; sc-11388; sc-166807; sc-1931; sc-271859; sc-29688; sc-29689; sc-30763; sc-30764; sc-365582
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse SP2/0
WB Suggested Anti-Anxa6 Antibody Titration: 5.0ug/ml
Positive Control: SP2/0 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |