Product Number |
ARP42839_T100 |
Product Page |
www.avivasysbio.com/rgs7-antibody-n-terminal-region-arp42839-t100.html |
Name |
Rgs7 Antibody - N-terminal region (ARP42839_T100) |
Protein Size (# AA) |
469 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
24012 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Regulator of G protein signaling 7 |
Peptide Sequence |
Synthetic peptide located within the following region: MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Rgs7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. It may play an important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations and in synaptic vesicle exocytosis |
Protein Interactions |
Rgs7bp; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Rgs7 (ARP42839_T100) antibody |
Blocking Peptide |
For anti-Rgs7 (ARP42839_T100) antibody is Catalog # AAP42839 (Previous Catalog # AAPS10605) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Rgs7 |
Uniprot ID |
P49802-2 |
Protein Name |
Regulator of G-protein signaling 7 |
Protein Accession # |
NP_036010 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_011880 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Rgs7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Human: 100%; Mouse: 100%; Rat: 93% |
Image 1 | Mouse NIH-3T3
| WB Suggested Anti-Rgs7 Antibody Titration: 5.0ug/ml Positive Control: NIH/3T3 cell lysate |
|
|