Rgs7 Antibody - N-terminal region (ARP42839_T100)

Data Sheet
 
Product Number ARP42839_T100
Product Page www.avivasysbio.com/rgs7-antibody-n-terminal-region-arp42839-t100.html
Name Rgs7 Antibody - N-terminal region (ARP42839_T100)
Protein Size (# AA) 469 amino acids
Molecular Weight 52kDa
NCBI Gene Id 24012
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Regulator of G protein signaling 7
Peptide Sequence Synthetic peptide located within the following region: MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Rgs7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. It may play an important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations and in synaptic vesicle exocytosis
Protein Interactions Rgs7bp;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Rgs7 (ARP42839_T100) antibody
Blocking Peptide For anti-Rgs7 (ARP42839_T100) antibody is Catalog # AAP42839 (Previous Catalog # AAPS10605)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse Rgs7
Uniprot ID P49802-2
Protein Name Regulator of G-protein signaling 7
Protein Accession # NP_036010
Purification Protein A purified
Nucleotide Accession # NM_011880
Tested Species Reactivity Mouse
Gene Symbol Rgs7
Predicted Species Reactivity Human, Mouse, Rat, Cow
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Rat: 93%
Image 1
Mouse NIH-3T3
WB Suggested Anti-Rgs7 Antibody Titration: 5.0ug/ml
Positive Control: NIH/3T3 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com