| Product Number |
ARP42819_T100 |
| Product Page |
www.avivasysbio.com/gja4-antibody-n-terminal-region-arp42819-t100.html |
| Name |
Gja4 Antibody - N-terminal region (ARP42819_T100) |
| Protein Size (# AA) |
333 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
14612 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gap junction protein, alpha 4 |
| Alias Symbols |
Cnx3, Cx37, Gja-, Cnx37, Cxnh1, Gja-4, AU020209, AW558810 |
| Peptide Sequence |
Synthetic peptide located within the following region: RREERLRQKEGELRALPSKDLHVERALAAIEHQMAKISVAEDGRLRIRGA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Gja4 (ARP42819_T100) antibody |
| Blocking Peptide |
For anti-Gja4 (ARP42819_T100) antibody is Catalog # AAP42819 (Previous Catalog # AAPS10409) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P35212 |
| Protein Name |
Gap junction alpha-4 protein |
| Protein Accession # |
NP_032146 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_008120 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Gja4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-Gja4 Antibody Titration: 5.0ug/ml
Positive Control: NIH/3T3 cell lysate |
|
|
