FOXR2 Antibody - N-terminal region (ARP42812_T100)

• Product Number: ARP42812_T100
• Name: FOXR2 Antibody - N-terminal region (ARP42812_T100)
• Protein Size (# AA): 311 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 139628
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Forkhead box R2
• Alias Symbols: FOXN6
• Peptide Sequence: Synthetic peptide located within the following region: VDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Katoh,M. (2004) Int. J. Mol. Med. 14 (1), 127-132
• Description of Target: Forkhead-box (FOX) transcription factors are implicated in carcinogenesis through gene amplification, retroviral integration, or chromosomal translocation. Human FOXN6 mRNA was expressed in breast cancer cell line and primary breast cancer.
• Protein Interactions: PEF1; SUV39H1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXR2 (ARP42812_T100) antibody is Catalog # AAP42812 (Previous Catalog # AAPS10402)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXR2
• Uniprot ID: Q6PJQ5
• Protein Name: Forkhead box protein R2
• Protein Accession #: NP_940853
• Purification: Protein A purified
• Nucleotide Accession #: NM_198451
• Tested Species Reactivity: Human
• Gene Symbol: FOXR2
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-FOXR2 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human kidney
  
  Human kidney