IRX3 Antibody - C-terminal region (ARP42801_P050)

Data Sheet
 
Product Number ARP42801_P050
Product Page www.avivasysbio.com/irx3-antibody-c-terminal-region-arp42801-p050.html
Name IRX3 Antibody - C-terminal region (ARP42801_P050)
Protein Size (# AA) 501 amino acids
Molecular Weight 52kDa
NCBI Gene Id 79191
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Iroquois homeobox 3
Alias Symbols IRX-1, IRXB1
Peptide Sequence Synthetic peptide located within the following region: SPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lewis,M.T., (1999) Cell Tissue Res. 296 (3), 549-554
Description of Target IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IRX3 (ARP42801_P050) antibody
Blocking Peptide For anti-IRX3 (ARP42801_P050) antibody is Catalog # AAP42801 (Previous Catalog # AAPS10303)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IRX3
Uniprot ID P78415
Protein Name Iroquois-class homeodomain protein IRX-3
Protein Accession # NP_077312
Purification Affinity Purified
Nucleotide Accession # NM_024336
Tested Species Reactivity Human
Gene Symbol IRX3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Horse: 90%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-IRX3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Skin
Human Skin
Image 3
Human Kidney
Rabbit Anti-IRX3 antibody
Catalog Number: ARP42801
Formalin Fixed Paraffin Embedded Tissue: Human Kidney
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 4
Human Uterus
Rabbit Anti-IRX3 antibody
Catalog Number: ARP42801
Formalin Fixed Paraffin Embedded Tissue: Human Uterus
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com