Product Number |
ARP42801_P050 |
Product Page |
www.avivasysbio.com/irx3-antibody-c-terminal-region-arp42801-p050.html |
Name |
IRX3 Antibody - C-terminal region (ARP42801_P050) |
Protein Size (# AA) |
501 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
79191 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Iroquois homeobox 3 |
Alias Symbols |
IRX-1, IRXB1 |
Peptide Sequence |
Synthetic peptide located within the following region: SPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGPRLHPLSLLGSAPPHL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lewis,M.T., (1999) Cell Tissue Res. 296 (3), 549-554 |
Description of Target |
IRX3 is a member of the Iroquois homeobox gene family that encodes a protein known for its essential role in spinal cord development. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-IRX3 (ARP42801_P050) antibody |
Blocking Peptide |
For anti-IRX3 (ARP42801_P050) antibody is Catalog # AAP42801 (Previous Catalog # AAPS10303) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human IRX3 |
Uniprot ID |
P78415 |
Protein Name |
Iroquois-class homeodomain protein IRX-3 |
Protein Accession # |
NP_077312 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024336 |
Tested Species Reactivity |
Human |
Gene Symbol |
IRX3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 90%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-IRX3 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human Skin
| Human Skin |
|
Image 3 | Human Kidney
| Rabbit Anti-IRX3 antibody Catalog Number: ARP42801 Formalin Fixed Paraffin Embedded Tissue: Human Kidney Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|
Image 4 | Human Uterus
| Rabbit Anti-IRX3 antibody Catalog Number: ARP42801 Formalin Fixed Paraffin Embedded Tissue: Human Uterus Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec
|
|