COX4I1 Antibody - N-terminal region (ARP42784_T100)

• Product Number: ARP42784_T100
• Name: COX4I1 Antibody - N-terminal region (ARP42784_T100)
• Protein Size (# AA): 169 amino acids
• Molecular Weight: 19kDa
• Subunit: 4 isoform 1, mitochondrial
• NCBI Gene Id: 1327
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cytochrome c oxidase subunit IV isoform 1
• Alias Symbols: COX4, COXIV, COX4-1, COXIV-1, MC4DN16, COX IV-1
• Peptide Sequence: Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Williams,S.L., (2004) J. Biol. Chem. 279 (9), 7462-7469
• Description of Target: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it.
• Protein Interactions: SDCBP; COX1; env; APP; UBC; ICT1; TMBIM4; NELFCD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-COX4I1 (ARP42784_T100) antibody is Catalog # AAP42784 (Previous Catalog # AAPS10110)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
• Uniprot ID: P13073
• Protein Name: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
• Publications:

  Geerling, J. J. et al. Metformin lowers plasma triglycerides by promoting VLDL-triglyceride clearance by brown adipose tissue in mice. Diabetes 63, 880-91 (2014). 24270984

  Snyder, A. M. et al. Mitochondrial ferritin in the substantia nigra in restless legs syndrome. J. Neuropathol. Exp. Neurol. 68, 1193-9 (2009). 19816198

• Sample Type Confirmation:

  COX4I1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_001852
• Purification: Protein A purified
• Nucleotide Accession #: NM_001861
• Tested Species Reactivity: Human
• Gene Symbol: COX4I1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB, IP
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86%
• Image 1: Human Heart
  
  Human Heart
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human, Mouse, Rat
  
  COX4I1 antibody - N-terminal region (ARP42784_T100) validated by WB using 1. Human liver
  2. Rat liver
  3. Wild-type mouse liver
  4. AMPKa1+2-/- mouse liver
  5. Human muscle
  6. Rat muscle
  7. Mouse muscle at 1:1000.
• Image 4: Human
  
  Lanes:
  Lane 1: 50ug HeLa lysate
  Lane 2: 50ug 293T lysate
  Lane 3: 50ug K562 lysate
  Lane 4: 50ug MDA-MB-231 lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit-HRP
  Secondary Antibody Dilution:
  1:1000
  Gene Name:
  COX4I1
  Submitted by:
  David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences
  
• Image 5: Human HepG2
  
  WB Suggested Anti-COX4I1 Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysateCOX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
• Image 6: Human Heart
  
  Rabbit Anti-COX4I1 Antibody
  Catalog Number: ARP42784
  Paraffin Embedded Tissue: Human cardiac cell
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 7: HEK293 Whole Cell Lysate
  
  COX4I1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP42784_T100 with 1:200 dilution. Western blot was performed using ARP42784_T100 at 1/1000 dilution.
  Lane 1: Control IP in HEK293 Whole Cell Lysate.
  Lane 2: COX4I1 IP with ARP42784_T100 in HEK293 Whole Cell Lysate.
  Lane 3: Input of HEK293 Whole Cell Lysate.