PANX2 Antibody - N-terminal region (ARP42778_T100)

• Product Number: ARP42778_T100
• Name: PANX2 Antibody - N-terminal region (ARP42778_T100)
• Protein Size (# AA): 633 amino acids
• Molecular Weight: 74 kDa
• NCBI Gene Id: 56666
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Pannexin 2
• Description:
  View product citations for PANX2 Antibody - N-terminal region (ARP42778_T100) on CiteAb
• Alias Symbols: PX2, hPANX2
• Peptide Sequence: Synthetic peptide located within the following region: GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Baranova,A., (2004) Genomics 83 (4), 706-716
• Description of Target: PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-PANX2 (ARP42778_T100) antibody is Catalog # AAP42778 (Previous Catalog # AAPS10104)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PANX2
• Uniprot ID: Q96RD6
• Protein Name: Pannexin-2
• Publications:

  Human stem cells express pannexins. BMC Res Notes. 11, 54 (2018). 29357945

  Lai, C. P. K., Bechberger, J. F. & Naus, C. C. Pannexin2 as a novel growth regulator in C6 glioma cells. Oncogene 28, 4402-8 (2009). 19749789

  Manipulation of Panx1 Activity Increases the Engraftment of Transplanted Lacrimal Gland Epithelial Progenitor Cells. Invest Ophthalmol Vis Sci. 58, 5654-5665 (2017). 29098296

  Mylvaganam, S. et al. Hippocampal seizures alter the expression of the pannexin and connexin transcriptome. J. Neurochem. 112, 92-102 (2010). 19840216

  Pannexin 2 is expressed in murine skin and promotes UVB-induced apoptosis of keratinocytes. Mol Biol Cell. mbcE21080387 (2022). 34985913

  Swayne, L. A., Sorbara, C. D. & Bennett, S. A. L. Pannexin 2 is expressed by postnatal hippocampal neural progenitors and modulates neuronal commitment. J. Biol. Chem. 285, 24977-86 (2010). 20529862

  Wang, X.-H., Streeter, M., Liu, Y.-P. & Zhao, H.-B. Identification and characterization of pannexin expression in the mammalian cochlea. J. Comp. Neurol. 512, 336-46 (2009). 19009624

  Wicki-Stordeur, L. E., Boyce, A. K. J. & Swayne, L. A. Analysis of a pannexin 2-pannexin 1 chimeric protein supports divergent roles for pannexin C-termini in cellular localization. Cell Commun. Adhes. 20, 73-9 (2013). 23659289

• Protein Accession #: NP_443071
• Purification: Protein A purified
• Nucleotide Accession #: NM_052839
• Tested Species Reactivity: Human
• Gene Symbol: PANX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Muscle
  
  Human Muscle
• Image 2: HepG2
  
  Host: Rabbit
  Target Name: PANX2
  Sample Type: HepG2
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 2.5ug/mL
  Peptide Concentration: 2.0ug/mL
  Lysate Quantity: 25ug/lane
  Gel Concentration: 12%
• Image 3: Human Liver, Human Lung
  
  Host: Rabbit
  Target: PANX2
  Positive control (+): Human Liver (LI)
  Negative control (-): Human Lung (LU)
  Antibody concentration: 0.5ug/ml
• Image 4: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Band appears higher due to modifications from glycosylation and phosphorylation.