Product Number |
ARP42770_P050 |
Product Page |
www.avivasysbio.com/rapgef2-antibody-middle-region-arp42770-p050.html |
Name |
Rapgef2 Antibody - middle region (ARP42770_P050) |
Protein Size (# AA) |
1494 amino acids |
Molecular Weight |
150kDa |
NCBI Gene Id |
76089 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Rap guanine nucleotide exchange factor (GEF) 2 |
Alias Symbols |
nR, CNRa, Pdzgef, RA-GEF, Pdzgef1, nRapGEP, CNRasGEF, RA-GEF-1, mKIAA0313, 5830453M24Rik |
Peptide Sequence |
Synthetic peptide located within the following region: SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function remains unknown. |
Protein Interactions |
Ywhaz; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Rapgef2 (ARP42770_P050) antibody |
Blocking Peptide |
For anti-Rapgef2 (ARP42770_P050) antibody is Catalog # AAP42770 (Previous Catalog # AAPP24992) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
Uniprot ID |
E9QNQ4 |
Protein Name |
Rap guanine nucleotide exchange factor 2 Ensembl ENSMUSP00000113778 |
Protein Accession # |
NP_001093094 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001099624 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
Rapgef2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human sperm and mouse liver
| Human sperm and mouse liver |
| Image 2 | Mouse Kidney
| WB Suggested Anti-Rapgef2 Antibody Titration: 1.0 ug/ml Positive Control: Mouse Kidney |
|
|