Rapgef2 Antibody - middle region (ARP42770_P050)

Data Sheet
 
Product Number ARP42770_P050
Product Page www.avivasysbio.com/rapgef2-antibody-middle-region-arp42770-p050.html
Name Rapgef2 Antibody - middle region (ARP42770_P050)
Protein Size (# AA) 1494 amino acids
Molecular Weight 150kDa
NCBI Gene Id 76089
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Rap guanine nucleotide exchange factor (GEF) 2
Alias Symbols nR, CNRa, Pdzgef, RA-GEF, Pdzgef1, nRapGEP, CNRasGEF, RA-GEF-1, mKIAA0313, 5830453M24Rik
Peptide Sequence Synthetic peptide located within the following region: SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function remains unknown.
Protein Interactions Ywhaz;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Rapgef2 (ARP42770_P050) antibody
Blocking Peptide For anti-Rapgef2 (ARP42770_P050) antibody is Catalog # AAP42770 (Previous Catalog # AAPP24992)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Uniprot ID E9QNQ4
Protein Name Rap guanine nucleotide exchange factor 2 Ensembl ENSMUSP00000113778
Protein Accession # NP_001093094
Purification Affinity Purified
Nucleotide Accession # NM_001099624
Tested Species Reactivity Human, Mouse
Gene Symbol Rapgef2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human sperm and mouse liver
Human sperm and mouse liver
Image 2
Mouse Kidney
WB Suggested Anti-Rapgef2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com