| Product Number |
ARP42721_T100 |
| Product Page |
www.avivasysbio.com/plpp1-antibody-n-terminal-region-arp42721-t100.html |
| Name |
PLPP1 Antibody - N-terminal region (ARP42721_T100) |
| Protein Size (# AA) |
285 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
8611 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
phospholipid phosphatase 1 |
| Alias Symbols |
LPP1, PAP2, LLP1a, PAP-2a, PPAP2A |
| Peptide Sequence |
Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tanyi,J.L., Clin. Cancer Res. 9 (10 PT 1), 3534-3545 (2003) |
| Description of Target |
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene. |
| Protein Interactions |
FAHD1; IGF2BP2; ILF3; UBC; FXYD1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLPP1 (ARP42721_T100) antibody |
| Blocking Peptide |
For anti-PLPP1 (ARP42721_T100) antibody is Catalog # AAP42721 (Previous Catalog # AAPP11105) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PPAP2A |
| Uniprot ID |
O14494-2 |
| Protein Name |
phospholipid phosphatase 1 |
| Publications |
Evseenko, D. et al. Lysophosphatidic acid mediates myeloid differentiation within the human bone marrow microenvironment. PLoS One 8, e63718 (2013). 23696850 |
| Protein Accession # |
NP_795714 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_176895 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLPP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Guinea Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 93% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human HepG2
 | WB Suggested Anti-PPAP2A Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate |
|
