Product Number |
ARP42714_P050 |
Product Page |
www.avivasysbio.com/itgb1bp3-antibody-middle-region-arp42714-p050.html |
Name |
ITGB1BP3 Antibody - middle region (ARP42714_P050) |
Protein Size (# AA) |
230 amino acids |
Molecular Weight |
26kDa |
NCBI Gene Id |
27231 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Integrin beta 1 binding protein 3 |
Alias Symbols |
MIBP, NRK2, ITGB1BP3 |
Peptide Sequence |
Synthetic peptide located within the following region: YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
0 |
Description of Target |
ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).ITGB1BP3 reduces laminin matrix deposition and cell adhesion to lami |
Protein Interactions |
APP; IGF2; LRP12; SAT1; ITGB1; CDKN1A; ST7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NMRK2 (ARP42714_P050) antibody |
Blocking Peptide |
For anti-NMRK2 (ARP42714_P050) antibody is Catalog # AAP42714 (Previous Catalog # AAPP24942) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ITGB1BP3 |
Uniprot ID |
Q9NPI5 |
Protein Name |
Nicotinamide riboside kinase 2 |
Protein Accession # |
NP_733778 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_170678 |
Tested Species Reactivity |
Human |
Gene Symbol |
NMRK2 |
Predicted Species Reactivity |
Human, Rat, Cow, Horse, Pig, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Horse: 86%; Human: 100%; Pig: 93%; Rat: 93%; Zebrafish: 93% |
Image 1 | Human Thymus
| WB Suggested Anti-ITGB1BP3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Thymus |
|
|