| Product Number |
ARP42708_P050 |
| Product Page |
www.avivasysbio.com/slc22a7-antibody-c-terminal-region-arp42708-p050.html |
| Name |
SLC22A7 Antibody - C-terminal region (ARP42708_P050) |
| Protein Size (# AA) |
235 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
10864 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 22 (organic anion transporter), member 7 |
| Alias Symbols |
NLT, OAT2, hOAT11 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
| Description of Target |
SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC22A7 (ARP42708_P050) antibody |
| Blocking Peptide |
For anti-SLC22A7 (ARP42708_P050) antibody is Catalog # AAP42708 (Previous Catalog # AAPP24936) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC22A7 |
| Uniprot ID |
Q9Y694 |
| Protein Name |
Solute carrier family 22 member 7 |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat |
| Protein Accession # |
NP_696961 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153320 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC22A7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 91%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-SLC22A7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SLC22A7 is expressed in Jurkat |
|
