Product Number |
ARP42696_T100 |
Product Page |
www.avivasysbio.com/rsad2-antibody-c-terminal-region-arp42696-t100.html |
Name |
RSAD2 Antibody - C-terminal region (ARP42696_T100) |
Protein Size (# AA) |
361 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
91543 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Radical S-adenosyl methionine domain containing 2 |
Alias Symbols |
cig5, vig1, cig33 |
Peptide Sequence |
Synthetic peptide located within the following region: YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Helbig,K.J., (2005) Hepatology 42 (3), 702-710 |
Description of Target |
RSAD2 is a potential antiviral effector. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RSAD2 (ARP42696_T100) antibody |
Blocking Peptide |
For anti-RSAD2 (ARP42696_T100) antibody is Catalog # AAP42696 (Previous Catalog # AAPP24927) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RSAD2 |
Uniprot ID |
Q8WXG1 |
Protein Name |
Radical S-adenosyl methionine domain-containing protein 2 |
Protein Accession # |
NP_542388 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_080657 |
Tested Species Reactivity |
Human |
Gene Symbol |
RSAD2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-RSAD2 Antibody Titration: 5.0ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Human kidney
| Human kidney |
|
|