RSAD2 Antibody - N-terminal region (ARP42695_T100)

Data Sheet
 
Product Number ARP42695_T100
Product Page www.avivasysbio.com/rsad2-antibody-n-terminal-region-arp42695-t100.html
Name RSAD2 Antibody - N-terminal region (ARP42695_T100)
Protein Size (# AA) 361 amino acids
Molecular Weight 40kDa
NCBI Gene Id 91543
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Radical S-adenosyl methionine domain containing 2
Alias Symbols cig5, vig1, cig33
Peptide Sequence Synthetic peptide located within the following region: PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Helbig,K.J., (2005) Hepatology 42 (3), 702-710
Description of Target RSAD2 is a potential antiviral effector. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RSAD2 (ARP42695_T100) antibody
Blocking Peptide For anti-RSAD2 (ARP42695_T100) antibody is Catalog # AAP42695 (Previous Catalog # AAPP24926)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RSAD2
Uniprot ID Q8WXG1
Protein Name Radical S-adenosyl methionine domain-containing protein 2
Protein Accession # NP_542388
Purification Protein A purified
Nucleotide Accession # NM_080657
Tested Species Reactivity Human
Gene Symbol RSAD2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-RSAD2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com