| Product Number |
ARP42686_T100 |
| Product Page |
www.avivasysbio.com/gzmh-antibody-n-terminal-region-arp42686-t100.html |
| Name |
GZMH Antibody - N-terminal region (ARP42686_T100) |
| Protein Size (# AA) |
246 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
2999 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Granzyme H (cathepsin G-like 2, protein h-CCPX) |
| Description |
|
| Alias Symbols |
CCP-X, CGL-2, CSP-C, CTLA1, CTSGL2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sedelies,K.A., (2004) J. Biol. Chem. 279 (25), 26581-26587 |
| Description of Target |
This enzyme is probably necessary for target cell lysis in cell-mediated immune responses. |
| Protein Interactions |
SSB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GZMH (ARP42686_T100) antibody |
| Blocking Peptide |
For anti-GZMH (ARP42686_T100) antibody is Catalog # AAP42686 (Previous Catalog # AAPP24919) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GZMH |
| Uniprot ID |
P20718 |
| Protein Name |
Granzyme H |
| Publications |
Deep immune profiling by mass cytometry links human T and NK cell differentiation and cytotoxic molecule expression patterns. J Immunol Methods. 453, 44472 (2018). 28322863 |
| Protein Accession # |
NP_219491 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_033423 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GZMH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 85%; Human: 100%; Mouse: 91%; Rat: 92% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-GZMH Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
