C5orf4 Antibody - N-terminal region (ARP42675_P050)

Data Sheet
 
Product Number ARP42675_P050
Product Page www.avivasysbio.com/c5orf4-antibody-n-terminal-region-arp42675-p050.html
Name C5orf4 Antibody - N-terminal region (ARP42675_P050)
Protein Size (# AA) 191 amino acids
Molecular Weight 21kDa
NCBI Gene Id 10826
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chromosome 5 open reading frame 4
Alias Symbols C5orf4
Peptide Sequence Synthetic peptide located within the following region: MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Boultwood,J., (2000) Genomics 66 (1), 26-34
Description of Target The function remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FAXDC2 (ARP42675_P050) antibody
Blocking Peptide For anti-FAXDC2 (ARP42675_P050) antibody is Catalog # AAP42675 (Previous Catalog # AAPP24908)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf4
Uniprot ID Q96IV6
Protein Name Uncharacterized protein C5orf4
Sample Type Confirmation

There is BioGPS gene expression data showing that FAXDC2 is expressed in HepG2

Protein Accession # NP_115761
Purification Affinity Purified
Nucleotide Accession # NM_032385
Tested Species Reactivity Human
Gene Symbol FAXDC2
Predicted Species Reactivity Human, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 92%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-C5orf4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that FAXDC2 is expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com