Product Number |
ARP42675_P050 |
Product Page |
www.avivasysbio.com/c5orf4-antibody-n-terminal-region-arp42675-p050.html |
Name |
C5orf4 Antibody - N-terminal region (ARP42675_P050) |
Protein Size (# AA) |
191 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
10826 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chromosome 5 open reading frame 4 |
Alias Symbols |
C5orf4 |
Peptide Sequence |
Synthetic peptide located within the following region: MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Boultwood,J., (2000) Genomics 66 (1), 26-34 |
Description of Target |
The function remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FAXDC2 (ARP42675_P050) antibody |
Blocking Peptide |
For anti-FAXDC2 (ARP42675_P050) antibody is Catalog # AAP42675 (Previous Catalog # AAPP24908) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf4 |
Uniprot ID |
Q96IV6 |
Protein Name |
Uncharacterized protein C5orf4 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that FAXDC2 is expressed in HepG2 |
Protein Accession # |
NP_115761 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_032385 |
Tested Species Reactivity |
Human |
Gene Symbol |
FAXDC2 |
Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 92% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human HepG2
| WB Suggested Anti-C5orf4 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that FAXDC2 is expressed in HepG2 |
|
|