| Product Number |
ARP42668_T100 |
| Product Page |
www.avivasysbio.com/alpg-antibody-n-terminal-region-arp42668-t100.html |
| Name |
ALPG Antibody - N-terminal region (ARP42668_T100) |
| Protein Size (# AA) |
532 amino acids |
| Molecular Weight |
59kDa |
| NCBI Gene Id |
251 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
alkaline phosphatase, germ cell |
| Alias Symbols |
GCAP, ALPPL, ALPPL2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Nakano,T., (2006) Biochem. Biophys. Res. Commun. 341 (1), 33-38 |
| Description of Target |
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. |
| Protein Interactions |
UBC; Cep76; Erh; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALPG (ARP42668_T100) antibody |
| Blocking Peptide |
For anti-ALPG (ARP42668_T100) antibody is Catalog # AAP42668 (Previous Catalog # AAPP24901) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ALPPL2 |
| Uniprot ID |
P10696 |
| Protein Name |
alkaline phosphatase, placental-like |
| Protein Accession # |
NP_112603 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_031313 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALPG |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 77%; Guinea Pig: 77%; Horse: 79%; Human: 100%; Mouse: 82%; Pig: 79%; Rabbit: 77%; Rat: 79% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate |
|
|
