Product Number |
ARP42662_P050 |
Product Page |
www.avivasysbio.com/edg8-antibody-n-terminal-region-arp42662-p050.html |
Name |
EDG8 Antibody - N-terminal region (ARP42662_P050) |
Protein Size (# AA) |
398 amino acids |
Molecular Weight |
44kDa |
NCBI Gene Id |
53637 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sphingosine-1-phosphate receptor 5 |
Alias Symbols |
EDG8, S1P5, Edg-8, SPPR-1, SPPR-2 |
Peptide Sequence |
Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
Description of Target |
EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. |
Protein Interactions |
TP63; GNA12; GNAO1; GNAI1; SGPP1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-S1PR5 (ARP42662_P050) antibody |
Blocking Peptide |
For anti-S1PR5 (ARP42662_P050) antibody is Catalog # AAP42662 (Previous Catalog # AAPP11573) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8 |
Uniprot ID |
Q9H228 |
Protein Name |
Sphingosine 1-phosphate receptor 5 |
Protein Accession # |
NP_110387 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_030760 |
Tested Species Reactivity |
Human |
Gene Symbol |
S1PR5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-EDG8 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human kidney
| Human kidney |
|