EDG8 Antibody - N-terminal region (ARP42661_T100)

Data Sheet
 
Product Number ARP42661_T100
Product Page www.avivasysbio.com/edg8-antibody-n-terminal-region-arp42661-t100.html
Name EDG8 Antibody - N-terminal region (ARP42661_T100)
Protein Size (# AA) 147 amino acids
Molecular Weight 16kDa
NCBI Gene Id 53637
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Sphingosine-1-phosphate receptor 5
Alias Symbols EDG8, S1P5, Edg-8, SPPR-1, SPPR-2
Peptide Sequence Synthetic peptide located within the following region: MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Guinn,B.A., (2005) Biochem. Biophys. Res. Commun. 335 (4), 1293-1304
Description of Target EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
Protein Interactions TP63; GNA12; GNAO1; GNAI1; SGPP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-S1PR5 (ARP42661_T100) antibody
Blocking Peptide For anti-S1PR5 (ARP42661_T100) antibody is Catalog # AAP43008 (Previous Catalog # AAPP11218)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EDG8
Uniprot ID Q9H228
Protein Name Sphingosine 1-phosphate receptor 5
Publications

Sphingosine 1-phospate differentially modulates maturation and function of human Langerhans-like cells. J. Dermatol. Sci. 82, 9-17 (2016). 26803226

Protein Accession # EAW84115
Purification Protein A purified
Nucleotide Accession # NM_003339
Tested Species Reactivity Human
Gene Symbol S1PR5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 80%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
Human Intestine
Human Intestine
Image 2
Human Jurkat
WB Suggested Anti-EDG8 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com