Product Number |
ARP42647_T100 |
Product Page |
www.avivasysbio.com/pp2447-antibody-n-terminal-region-arp42647-t100.html |
Name |
PP2447 Antibody - N-terminal region (ARP42647_T100) |
Protein Size (# AA) |
376 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
80305 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
TraB domain containing |
Alias Symbols |
LP6054, PP2447 |
Peptide Sequence |
Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The function remains unknown. |
Protein Interactions |
UBC; HIPK4; ILK; BECN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TRABD (ARP42647_T100) antibody |
Blocking Peptide |
For anti-TRABD (ARP42647_T100) antibody is Catalog # AAP42647 (Previous Catalog # AAPP24880) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PP2447 |
Uniprot ID |
Q9H4I3 |
Protein Name |
TraB domain-containing protein |
Protein Accession # |
NP_079480 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_025204 |
Tested Species Reactivity |
Human |
Gene Symbol |
TRABD |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-PP2447 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|
|