PP2447 Antibody - N-terminal region (ARP42647_T100)

Data Sheet
 
Product Number ARP42647_T100
Product Page www.avivasysbio.com/pp2447-antibody-n-terminal-region-arp42647-t100.html
Name PP2447 Antibody - N-terminal region (ARP42647_T100)
Protein Size (# AA) 376 amino acids
Molecular Weight 41kDa
NCBI Gene Id 80305
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name TraB domain containing
Alias Symbols LP6054, PP2447
Peptide Sequence Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The function remains unknown.
Protein Interactions UBC; HIPK4; ILK; BECN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRABD (ARP42647_T100) antibody
Blocking Peptide For anti-TRABD (ARP42647_T100) antibody is Catalog # AAP42647 (Previous Catalog # AAPP24880)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PP2447
Uniprot ID Q9H4I3
Protein Name TraB domain-containing protein
Protein Accession # NP_079480
Purification Protein A purified
Nucleotide Accession # NM_025204
Tested Species Reactivity Human
Gene Symbol TRABD
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-PP2447 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com