C6orf134 Antibody - N-terminal region (ARP42642_T100)

• Product Number: ARP42642_T100
• Name: C6orf134 Antibody - N-terminal region (ARP42642_T100)
• Protein Size (# AA): 323 amino acids
• Molecular Weight: 47 kDa
• NCBI Gene Id: 79969
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Alpha tubulin acetyltransferase 1
• Alias Symbols: TAT, MEC17, C6orf134, Nbla00487, alpha-TAT, alpha-TAT1
• Peptide Sequence: Synthetic peptide located within the following region: MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Isogai,T. Unpublished (2000)
• Description of Target: The function remains unknown.
• Protein Interactions: SRPK2; APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-ATAT1 (ARP42642_T100) antibody is Catalog # AAP42642 (Previous Catalog # AAPP24875)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf134
• Uniprot ID: Q9H8X5
• Protein Name: Alpha-tubulin N-acetyltransferase
• Sample Type Confirmation:

  ATAT1 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_079185
• Purification: Protein A purified
• Nucleotide Accession #: NM_024909
• Tested Species Reactivity: Human
• Gene Symbol: ATAT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Ovary, Human lung
  
  Host: Rabbit
  Target: ATAT1
  Positive control (+): Human Ovary (OV)
  Negative control (-): Human lung (LU)
  Antibody concentration: 1ug/ml
• Image 2: Human HepG2
  
  WB Suggested Anti-C6orf134 Antibody Titration: 2.5ug/ml
  Positive Control: HepG2 cell lysateATAT1 is supported by BioGPS gene expression data to be expressed in HepG2