Product Number |
ARP42601_P050 |
Product Page |
www.avivasysbio.com/chia-antibody-n-terminal-region-arp42601-p050.html |
Name |
CHIA Antibody - N-terminal region (ARP42601_P050) |
Protein Size (# AA) |
368 amino acids |
Molecular Weight |
40kDa |
NCBI Gene Id |
27159 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chitinase, acidic |
Alias Symbols |
CHIT2, AMCASE, TSA1902 |
Peptide Sequence |
Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Chou,Y.T., (2006) Biochemistry 45 (14), 4444-4454 |
Description of Target |
CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHIA (ARP42601_P050) antibody |
Blocking Peptide |
For anti-CHIA (ARP42601_P050) antibody is Catalog # AAP42601 (Previous Catalog # AAPP24837) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHIA |
Uniprot ID |
Q9BZP6 |
Protein Name |
Acidic mammalian chitinase |
Publications |
Fukushima, T., Nashida, T., Haga-Tsujimura, M. & Mataga, I. Chitinase expression in parotid glands of non-obese diabetic mice. Oral Dis. 18, 506-12 (2012). 22309644
Strobel, S., Roswag, A., Becker, N. I., Trenczek, T. E. & Encarnação, J. A. Insectivorous bats digest chitin in the stomach using acidic mammalian chitinase. PLoS One 8, e72770 (2013). 24019876 |
Protein Accession # |
NP_068569 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_021797 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHIA |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Fetal Heart
| Host: Rabbit Target Name: CHIA Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human Fetal Lung
| Host: Rabbit Target Name: CHIA Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human Fetal Liver
| Host: Rabbit Target Name: CHIA Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 4 | Transfected 293T
| WB Suggested Anti-CHIA Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Transfected 293T |
|