Product Number |
ARP42595_T100 |
Product Page |
www.avivasysbio.com/dnase2b-antibody-c-terminal-region-arp42595-t100.html |
Name |
DNASE2B Antibody - C-terminal region (ARP42595_T100) |
Protein Size (# AA) |
153 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
58511 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Deoxyribonuclease II beta |
Alias Symbols |
DLAD |
Peptide Sequence |
Synthetic peptide located within the following region: MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
MacLea,K.S., (2003) Gene 305 (1), 1-12 |
Description of Target |
DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs.The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. |
Protein Interactions |
UBC; UBD; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DNASE2B (ARP42595_T100) antibody |
Blocking Peptide |
For anti-DNASE2B (ARP42595_T100) antibody is Catalog # AAP42595 (Previous Catalog # AAPP24831) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DNASE2B |
Uniprot ID |
Q5VXD0 |
Protein Name |
Deoxyribonuclease-2-beta |
Protein Accession # |
NP_490649 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_058248 |
Tested Species Reactivity |
Human |
Gene Symbol |
DNASE2B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 77%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-DNASE2B Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
|