Product Number |
ARP42588_T100 |
Product Page |
www.avivasysbio.com/cyp4f11-antibody-n-terminal-region-arp42588-t100.html |
Name |
CYP4F11 Antibody - N-terminal region (ARP42588_T100) |
Protein Size (# AA) |
524 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
57834 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cytochrome P450, family 4, subfamily F, polypeptide 11 |
Alias Symbols |
CYPIVF11 |
Peptide Sequence |
Synthetic peptide located within the following region: FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Cui,X., (2000) Genomics 68 (2), 161-166 |
Description of Target |
CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F2, is approximately 16 kb away. |
Protein Interactions |
POT1; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CYP4F11 (ARP42588_T100) antibody |
Blocking Peptide |
For anti-CYP4F11 (ARP42588_T100) antibody is Catalog # AAP42588 (Previous Catalog # AAPP24824) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4F11 |
Uniprot ID |
Q9HBI6 |
Protein Name |
Cytochrome P450 4F11 |
Protein Accession # |
NP_067010 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_021187 |
Tested Species Reactivity |
Human |
Gene Symbol |
CYP4F11 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 82%; Horse: 82%; Human: 100%; Mouse: 91%; Rabbit: 83%; Rat: 83% |
Image 1 | Human HepG2
| WB Suggested Anti-CYP4F11 Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysate |
|
|