CYP4F11 Antibody - N-terminal region (ARP42588_T100)

Data Sheet
 
Product Number ARP42588_T100
Product Page www.avivasysbio.com/cyp4f11-antibody-n-terminal-region-arp42588-t100.html
Name CYP4F11 Antibody - N-terminal region (ARP42588_T100)
Protein Size (# AA) 524 amino acids
Molecular Weight 58kDa
NCBI Gene Id 57834
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cytochrome P450, family 4, subfamily F, polypeptide 11
Alias Symbols CYPIVF11
Peptide Sequence Synthetic peptide located within the following region: FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Cui,X., (2000) Genomics 68 (2), 161-166
Description of Target CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F2, is approximately 16 kb away.
Protein Interactions POT1; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CYP4F11 (ARP42588_T100) antibody
Blocking Peptide For anti-CYP4F11 (ARP42588_T100) antibody is Catalog # AAP42588 (Previous Catalog # AAPP24824)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CYP4F11
Uniprot ID Q9HBI6
Protein Name Cytochrome P450 4F11
Protein Accession # NP_067010
Purification Protein A purified
Nucleotide Accession # NM_021187
Tested Species Reactivity Human
Gene Symbol CYP4F11
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 82%; Horse: 82%; Human: 100%; Mouse: 91%; Rabbit: 83%; Rat: 83%
Image 1
Human HepG2
WB Suggested Anti-CYP4F11 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com