| Product Number |
ARP42577_T100 |
| Product Page |
www.avivasysbio.com/psg3-antibody-n-terminal-region-arp42577-t100.html |
| Name |
PSG3 Antibody - N-terminal region (ARP42577_T100) |
| Protein Size (# AA) |
143 amino acids |
| Molecular Weight |
16kDa |
| NCBI Gene Id |
5671 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pregnancy specific beta-1-glycoprotein 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
FAM46A; PRKD2; SKIL; ATF7IP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PSG3 (ARP42577_T100) antibody |
| Blocking Peptide |
For anti-PSG3 (ARP42577_T100) antibody is Catalog # AAP42577 (Previous Catalog # AAPP24813) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PSG3 |
| Uniprot ID |
Q16557 |
| Protein Accession # |
AAD28498 |
| Purification |
Protein A purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PSG3 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-PSG3 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
