| Product Number |
ARP42553_T100 |
| Product Page |
www.avivasysbio.com/akr1b10-antibody-n-terminal-region-arp42553-t100.html |
| Name |
AKR1B10 Antibody - N-terminal region (ARP42553_T100) |
| Protein Size (# AA) |
316 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
57016 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Aldo-keto reductase family 1, member B10 (aldose reductase) |
| Alias Symbols |
HIS, HSI, ARL1, ARL-1, ALDRLn, AKR1B11, AKR1B12 |
| Peptide Sequence |
Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lee,Y.S., (2005) Int. J. Biochem. Cell Biol. 37 (11), 2297-2309 |
| Description of Target |
AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. |
| Protein Interactions |
NOS2; TERF2IP; ACACA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AKR1B10 (ARP42553_T100) antibody |
| Blocking Peptide |
For anti-AKR1B10 (ARP42553_T100) antibody is Catalog # AAP42553 (Previous Catalog # AAPP11040) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AKR1B10 |
| Uniprot ID |
O60218 |
| Protein Name |
Aldo-keto reductase family 1 member B10 |
| Sample Type Confirmation |
AKR1B10 is supported by BioGPS gene expression data to be expressed in A549 |
| Protein Accession # |
NP_064695 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_020299 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AKR1B10 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Yeast: 100%; Zebrafish: 100% |
| Image 1 | Human A549
 | WB Suggested Anti-AKR1B10 Antibody Titration: 1.25ug/ml
Positive Control: A549 cell lysateAKR1B10 is supported by BioGPS gene expression data to be expressed in A549 |
|
