Product Number |
ARP42515_P050 |
Product Page |
www.avivasysbio.com/lrp2bp-antibody-middle-region-arp42515-p050.html |
Name |
LRP2BP Antibody - middle region (ARP42515_P050) |
Protein Size (# AA) |
347 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
55805 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
LRP2 binding protein |
Alias Symbols |
DKFZp761O0113 |
Peptide Sequence |
Synthetic peptide located within the following region: RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Li,J., (2005) Cell. Mol. Biol. Lett. 10 (1), 185-193 |
Description of Target |
The function remains unknown. |
Protein Interactions |
TSC22D4; PICK1; COPS3; SNW1; BAI2; RBM4; LRP2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRP2BP (ARP42515_P050) antibody |
Blocking Peptide |
For anti-LRP2BP (ARP42515_P050) antibody is Catalog # AAP42515 (Previous Catalog # AAPP11005) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LRP2BP |
Uniprot ID |
A6NJR7 |
Protein Name |
LRP2-binding protein |
Protein Accession # |
NP_060879 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018409 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRP2BP |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-LRP2BP Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|