Product Number |
ARP42507_T100 |
Product Page |
www.avivasysbio.com/bsdc1-antibody-n-terminal-region-arp42507-t100.html |
Name |
BSDC1 Antibody - N-terminal region (ARP42507_T100) |
Protein Size (# AA) |
154 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
55108 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
BSD domain containing 1 |
Alias Symbols |
RP4-811H24.7, DKFZp686B09139, FLJ10276 |
Peptide Sequence |
Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Collins,J.E., Genome Biol. 5 (10), R84 (2004) |
Description of Target |
The function remains unknown.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Protein Interactions |
KLC1; UBC; Bsdc1; PHC2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-BSDC1 (ARP42507_T100) antibody |
Blocking Peptide |
For anti-BSDC1 (ARP42507_T100) antibody is Catalog # AAP43025 (Previous Catalog # AAPP11232) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BSDC1 |
Uniprot ID |
Q9NW68-3 |
Protein Name |
BSD domain-containing protein 1 |
Protein Accession # |
NP_060515 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003347 |
Tested Species Reactivity |
Human |
Gene Symbol |
BSDC1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human Jurkat
| WB Suggested Anti-BSDC1 Antibody Titration: 2.5ug/ml Positive Control: Jurkat cell lysate |
|
|