BSDC1 Antibody - N-terminal region (ARP42507_T100)

Data Sheet
 
Product Number ARP42507_T100
Product Page www.avivasysbio.com/bsdc1-antibody-n-terminal-region-arp42507-t100.html
Name BSDC1 Antibody - N-terminal region (ARP42507_T100)
Protein Size (# AA) 154 amino acids
Molecular Weight 17kDa
NCBI Gene Id 55108
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name BSD domain containing 1
Alias Symbols RP4-811H24.7, DKFZp686B09139, FLJ10276
Peptide Sequence Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Collins,J.E., Genome Biol. 5 (10), R84 (2004)
Description of Target The function remains unknown.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Protein Interactions KLC1; UBC; Bsdc1; PHC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BSDC1 (ARP42507_T100) antibody
Blocking Peptide For anti-BSDC1 (ARP42507_T100) antibody is Catalog # AAP43025 (Previous Catalog # AAPP11232)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BSDC1
Uniprot ID Q9NW68-3
Protein Name BSD domain-containing protein 1
Protein Accession # NP_060515
Purification Protein A purified
Nucleotide Accession # NM_003347
Tested Species Reactivity Human
Gene Symbol BSDC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-BSDC1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com