Product Number |
ARP42500_T100 |
Product Page |
www.avivasysbio.com/cuedc1-antibody-middle-region-arp42500-t100.html |
Name |
CUEDC1 Antibody - middle region (ARP42500_T100) |
Protein Size (# AA) |
386 amino acids |
Molecular Weight |
42kDa |
NCBI Gene Id |
404093 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
CUE domain containing 1 |
Alias Symbols |
DKFZp547L163, FLJ20739 |
Peptide Sequence |
Synthetic peptide located within the following region: RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sugano,S., Unpublished (2000) |
Description of Target |
The function remains unknown. |
Protein Interactions |
SMURF2; Nedd4; NEDD4L; UBC; IKBKG; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CUEDC1 (ARP42500_T100) antibody |
Blocking Peptide |
For anti-CUEDC1 (ARP42500_T100) antibody is Catalog # AAP42500 (Previous Catalog # AAPS13002) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CUEDC1 |
Uniprot ID |
Q9NWM3 |
Protein Name |
CUE domain-containing protein 1 |
Protein Accession # |
NP_060419 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_017949 |
Tested Species Reactivity |
Human |
Gene Symbol |
CUEDC1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-CUEDC1 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|
|