CUEDC1 Antibody - middle region (ARP42500_T100)

Data Sheet
 
Product Number ARP42500_T100
Product Page www.avivasysbio.com/cuedc1-antibody-middle-region-arp42500-t100.html
Name CUEDC1 Antibody - middle region (ARP42500_T100)
Protein Size (# AA) 386 amino acids
Molecular Weight 42kDa
NCBI Gene Id 404093
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name CUE domain containing 1
Alias Symbols DKFZp547L163, FLJ20739
Peptide Sequence Synthetic peptide located within the following region: RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sugano,S., Unpublished (2000)
Description of Target The function remains unknown.
Protein Interactions SMURF2; Nedd4; NEDD4L; UBC; IKBKG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CUEDC1 (ARP42500_T100) antibody
Blocking Peptide For anti-CUEDC1 (ARP42500_T100) antibody is Catalog # AAP42500 (Previous Catalog # AAPS13002)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CUEDC1
Uniprot ID Q9NWM3
Protein Name CUE domain-containing protein 1
Protein Accession # NP_060419
Purification Protein A purified
Nucleotide Accession # NM_017949
Tested Species Reactivity Human
Gene Symbol CUEDC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Human HepG2
WB Suggested Anti-CUEDC1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com