| Product Number |
ARP42496_P050 |
| Product Page |
www.avivasysbio.com/flj20489-antibody-c-terminal-region-arp42496-p050.html |
| Name |
FLJ20489 Antibody - C-terminal region (ARP42496_P050) |
| Protein Size (# AA) |
239 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
55652 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 48 (heme transporter), member 1 |
| Alias Symbols |
HRG1, HRG-1, hHRG-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
The function remains unknown. |
| Protein Interactions |
MEOX2; APP; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC48A1 (ARP42496_P050) antibody |
| Blocking Peptide |
For anti-SLC48A1 (ARP42496_P050) antibody is Catalog # AAP42496 (Previous Catalog # AAPS12910) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ20489 |
| Uniprot ID |
Q9NX17 |
| Protein Name |
Heme transporter HRG1 |
| Protein Accession # |
NP_060312 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017842 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC48A1 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Image 1 | Human HepG2
 | WB Suggested Anti-FLJ20489 Antibody Titration: 0.0625ug/ml
Positive Control: HepG2 cell lysate |
| | Image 2 | Human Placenta
 | Human Placenta |
| | Image 3 | Human A549 Whole Cell
 | Host: Rabbit
Target Name: SLC48A1
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml |
|
|
