ASPN Antibody - middle region (ARP42487_T100)

Data Sheet
 
Product Number ARP42487_T100
Product Page www.avivasysbio.com/aspn-antibody-middle-region-arp42487-t100.html
Name ASPN Antibody - middle region (ARP42487_T100)
Protein Size (# AA) 380 amino acids
Molecular Weight 43 kDa
NCBI Gene Id 54829
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Asporin
Alias Symbols OS3, PLAP1, PLAP-1, SLRR1C
Peptide Sequence Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kizawa,H., (2005) Nat. Genet. 37 (2), 138-144
Description of Target ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001).[supplied by OMIM].
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-ASPN (ARP42487_T100) antibody
Blocking Peptide For anti-ASPN (ARP42487_T100) antibody is Catalog # AAP42487 (Previous Catalog # AAPS12901)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ASPN
Uniprot ID Q5TBF3
Protein Name Asporin
Protein Accession # NP_060150
Purification Protein A purified
Nucleotide Accession # NM_017680
Tested Species Reactivity Human
Gene Symbol ASPN
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 100%; Zebrafish: 90%
Image 1
Lung tumor, MCF7
Host: Rabbit
Target: ASPN
Positive control (+): Lung tumor (T-LU)
Negative control (-): MCF7 (N10)
Antibody concentration: 1ug/ml
Image 2
Human Muscle
Human Muscle
Image 3
Human HepG2
WB Suggested Anti-ASPN Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com