Product Number |
ARP42487_T100 |
Product Page |
www.avivasysbio.com/aspn-antibody-middle-region-arp42487-t100.html |
Name |
ASPN Antibody - middle region (ARP42487_T100) |
Protein Size (# AA) |
380 amino acids |
Molecular Weight |
43 kDa |
NCBI Gene Id |
54829 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Asporin |
Alias Symbols |
OS3, PLAP1, PLAP-1, SLRR1C |
Peptide Sequence |
Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kizawa,H., (2005) Nat. Genet. 37 (2), 138-144 |
Description of Target |
ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001).[supplied by OMIM]. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-ASPN (ARP42487_T100) antibody |
Blocking Peptide |
For anti-ASPN (ARP42487_T100) antibody is Catalog # AAP42487 (Previous Catalog # AAPS12901) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ASPN |
Uniprot ID |
Q5TBF3 |
Protein Name |
Asporin |
Protein Accession # |
NP_060150 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_017680 |
Tested Species Reactivity |
Human |
Gene Symbol |
ASPN |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 100%; Zebrafish: 90% |
Image 1 | Lung tumor, MCF7
| Host: Rabbit Target: ASPN Positive control (+): Lung tumor (T-LU) Negative control (-): MCF7 (N10) Antibody concentration: 1ug/ml |
|
Image 2 | Human Muscle
| Human Muscle |
|
Image 3 | Human HepG2
| WB Suggested Anti-ASPN Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|