HAO1 Antibody - C-terminal region (ARP42480_P050)

Data Sheet
 
Product Number ARP42480_P050
Product Page www.avivasysbio.com/hao1-antibody-c-terminal-region-arp42480-p050.html
Name HAO1 Antibody - C-terminal region (ARP42480_P050)
Protein Size (# AA) 370 amino acids
Molecular Weight 41kDa
NCBI Gene Id 54363
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Hydroxyacid oxidase (glycolate oxidase) 1
Alias Symbols GOX, GOX1, HAOX1
Peptide Sequence Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Williams,E., Biochim. Biophys. Acta 1493 (1-2), 246-248 (2000)
Description of Target Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site.
Protein Interactions PEX5; HCVgp1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HAO1 (ARP42480_P050) antibody
Blocking Peptide For anti-HAO1 (ARP42480_P050) antibody is Catalog # AAP42480 (Previous Catalog # AAPS12806)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HAO1
Uniprot ID Q9UJM8
Protein Name Hydroxyacid oxidase 1
Protein Accession # NP_060015
Purification Affinity Purified
Nucleotide Accession # NM_017545
Tested Species Reactivity Human
Gene Symbol HAO1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Image 1
Human Liver
WB Suggested Anti-HAO1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com