Product Number |
ARP42480_P050 |
Product Page |
www.avivasysbio.com/hao1-antibody-c-terminal-region-arp42480-p050.html |
Name |
HAO1 Antibody - C-terminal region (ARP42480_P050) |
Protein Size (# AA) |
370 amino acids |
Molecular Weight |
41kDa |
NCBI Gene Id |
54363 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Hydroxyacid oxidase (glycolate oxidase) 1 |
Alias Symbols |
GOX, GOX1, HAOX1 |
Peptide Sequence |
Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Williams,E., Biochim. Biophys. Acta 1493 (1-2), 246-248 (2000) |
Description of Target |
Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. |
Protein Interactions |
PEX5; HCVgp1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HAO1 (ARP42480_P050) antibody |
Blocking Peptide |
For anti-HAO1 (ARP42480_P050) antibody is Catalog # AAP42480 (Previous Catalog # AAPS12806) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HAO1 |
Uniprot ID |
Q9UJM8 |
Protein Name |
Hydroxyacid oxidase 1 |
Protein Accession # |
NP_060015 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017545 |
Tested Species Reactivity |
Human |
Gene Symbol |
HAO1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100% |
Image 1 | Human Liver
| WB Suggested Anti-HAO1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver |
|
|