Product Number |
ARP42474_P050 |
Product Page |
www.avivasysbio.com/pipox-antibody-c-terminal-region-arp42474-p050.html |
Name |
PIPOX Antibody - C-terminal region (ARP42474_P050) |
Protein Size (# AA) |
390 amino acids |
Molecular Weight |
43kDa |
NCBI Gene Id |
51268 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Pipecolic acid oxidase |
Alias Symbols |
LPIPOX |
Peptide Sequence |
Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
IJlst,L., (2000) Biochem. Biophys. Res. Commun. 270 (3), 1101-1105 |
Description of Target |
PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline. |
Protein Interactions |
PEX5; POT1; ODF2L; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PIPOX (ARP42474_P050) antibody |
Blocking Peptide |
For anti-PIPOX (ARP42474_P050) antibody is Catalog # AAP42474 (Previous Catalog # AAPS12712) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PIPOX |
Uniprot ID |
Q9P0Z9 |
Protein Name |
Peroxisomal sarcosine oxidase |
Protein Accession # |
NP_057602 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016518 |
Tested Species Reactivity |
Human |
Gene Symbol |
PIPOX |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
Image 1 | Human Jurkat
| WB Suggested Anti-PIPOX Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|