| Product Number |
ARP42474_P050 |
| Product Page |
www.avivasysbio.com/pipox-antibody-c-terminal-region-arp42474-p050.html |
| Name |
PIPOX Antibody - C-terminal region (ARP42474_P050) |
| Protein Size (# AA) |
390 amino acids |
| Molecular Weight |
43kDa |
| NCBI Gene Id |
51268 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Pipecolic acid oxidase |
| Alias Symbols |
LPIPOX |
| Peptide Sequence |
Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
IJlst,L., (2000) Biochem. Biophys. Res. Commun. 270 (3), 1101-1105 |
| Description of Target |
PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline. |
| Protein Interactions |
PEX5; POT1; ODF2L; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PIPOX (ARP42474_P050) antibody |
| Blocking Peptide |
For anti-PIPOX (ARP42474_P050) antibody is Catalog # AAP42474 (Previous Catalog # AAPS12712) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PIPOX |
| Uniprot ID |
Q9P0Z9 |
| Protein Name |
Peroxisomal sarcosine oxidase |
| Protein Accession # |
NP_057602 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016518 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PIPOX |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-PIPOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate |
|
|
