C9orf127 Antibody - middle region (ARP42472_T100)

Data Sheet
 
Product Number ARP42472_T100
Product Page www.avivasysbio.com/c9orf127-antibody-middle-region-arp42472-t100.html
Name C9orf127 Antibody - middle region (ARP42472_T100)
Protein Size (# AA) 472 amino acids
Molecular Weight 52kDa
NCBI Gene Id 51754
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transmembrane protein 8B
Alias Symbols NAG5, NGX6, FP588, NAG-5, NGX6a, C9orf127, LINC00950
Peptide Sequence Synthetic peptide located within the following region: THNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.
Protein Interactions ATXN1L; EZR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEM8B (ARP42472_T100) antibody
Blocking Peptide For anti-TMEM8B (ARP42472_T100) antibody is Catalog # AAP42472 (Previous Catalog # AAPS12710)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C9orf127
Uniprot ID Q5TCW5
Protein Name Transmembrane protein 8B
Protein Accession # NP_001036054
Purification Protein A purified
Nucleotide Accession # NM_001042589
Tested Species Reactivity Human
Gene Symbol TMEM8B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-C9orf127 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com