DCXR Antibody - middle region (ARP42462_P050)

Data Sheet
 
Product Number ARP42462_P050
Product Page www.avivasysbio.com/dcxr-antibody-middle-region-arp42462-p050.html
Name DCXR Antibody - middle region (ARP42462_P050)
Protein Size (# AA) 244 amino acids
Molecular Weight 27kDa
NCBI Gene Id 51181
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Dicarbonyl/L-xylulose reductase
Alias Symbols XR, DCR, HCR2, P34H, HCRII, KIDCR, PNTSU, SDR20C1
Peptide Sequence Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sullivan,R., (2006) Fertil. Steril. 85 (5), 1557-1559
Description of Target DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities (Nakagawa et al., 2002).[supplied by OMIM].
Protein Interactions DCXR; UBC; CRADD; APP; DMWD;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DCXR (ARP42462_P050) antibody
Blocking Peptide For anti-DCXR (ARP42462_P050) antibody is Catalog # AAP42462 (Previous Catalog # AAPS12702)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DCXR
Uniprot ID Q7Z4W1
Protein Name L-xylulose reductase
Protein Accession # NP_057370
Purification Affinity Purified
Nucleotide Accession # NM_016286
Tested Species Reactivity Human
Gene Symbol DCXR
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Jurkat
WB Suggested Anti-DCXR Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com