NELF Antibody - middle region (ARP42449_T100)

• Product Number: ARP42449_T100
• Name: NELF Antibody - middle region (ARP42449_T100)
• Protein Size (# AA): 263 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 26012
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Nasal embryonic LHRH factor
• Alias Symbols: HH9, NELF
• Peptide Sequence: Synthetic peptide located within the following region: RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
• Protein Interactions: SUPT5H; POLR2A; GFI1B; HSPB3; RAN;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NSMF (ARP42449_T100) antibody is Catalog # AAP42449 (Previous Catalog # AAPP24792)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NELF
• Uniprot ID: Q6X4W1
• Protein Name: Nasal embryonic luteinizing hormone-releasing hormone factor
• Sample Type Confirmation:

  NSMF is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: EAW88391
• Purification: Protein A purified
• Nucleotide Accession #: NM_001130969
• Tested Species Reactivity: Human
• Gene Symbol: NSMF
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-NELF Antibody Titration: 5.0ug/ml
  Positive Control: HepG2 cell lysateNSMF is supported by BioGPS gene expression data to be expressed in HepG2