| Product Number |
ARP42443_T100 |
| Product Page |
www.avivasysbio.com/psd3-antibody-middle-region-arp42443-t100.html |
| Name |
PSD3 Antibody - middle region (ARP42443_T100) |
| Protein Size (# AA) |
513 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
23362 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pleckstrin and Sec7 domain containing 3 |
| Alias Symbols |
EFA6D, EFA6R, HCA67 |
| Peptide Sequence |
Synthetic peptide located within the following region: SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pils,D., (2005) Cancer 104 (11), 2417-2429 |
| Description of Target |
PSD3 is a guanine nucleotide exchange factor for ARF6. |
| Protein Interactions |
UBC; ARAP1; PMS2; MLH1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PSD3 (ARP42443_T100) antibody |
| Blocking Peptide |
For anti-PSD3 (ARP42443_T100) antibody is Catalog # AAP42443 (Previous Catalog # AAPP24786) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PSD3 |
| Uniprot ID |
Q9NYI0-3 |
| Protein Name |
PH and SEC7 domain-containing protein 3 |
| Sample Type Confirmation |
PSD3 is strongly supported by BioGPS gene expression data to be expressed in A204 |
| Protein Accession # |
NP_996792 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_206909 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PSD3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human A204
 | WB Suggested Anti-PSD3 Antibody Titration: 2.5ug/ml
Positive Control: A204 cell lysatePSD3 is strongly supported by BioGPS gene expression data to be expressed in Human A204 cells |
| | Image 2 | Human Muscle
 | Human Muscle |
|
|
