| Product Number |
ARP42436_P050 |
| Product Page |
www.avivasysbio.com/exph5-antibody-middle-region-arp42436-p050.html |
| Name |
EXPH5 Antibody - middle region (ARP42436_P050) |
| Protein Size (# AA) |
1989 amino acids |
| Molecular Weight |
222kDa |
| NCBI Gene Id |
23086 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Exophilin 5 |
| Alias Symbols |
SLAC2B, SLAC2-B |
| Peptide Sequence |
Synthetic peptide located within the following region: QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Colland,F., (2004) Genome Res. 14 (7), 1324-1332 |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
SMAD9; ELAVL1; UBC; APC; RAB27A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EXPH5 (ARP42436_P050) antibody |
| Blocking Peptide |
For anti-EXPH5 (ARP42436_P050) antibody is Catalog # AAP42436 (Previous Catalog # AAPP24779) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EXPH5 |
| Uniprot ID |
Q149M6 |
| Protein Name |
Exophilin 5 EMBL AAI17702.1 |
| Protein Accession # |
NP_055880 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015065 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EXPH5 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 92% |
| Image 1 | Human ACHN
 | WB Suggested Anti-EXPH5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate |
|
| Image 2 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: EXPH5
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 3 | Human H69 Whole Cell
 | Host: Rabbit
Target Name: EXPH5
Sample Tissue: Human H69 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 4 | Human sperm extract
 | Human sperm extract |
|
