COBLL1 antibody - N-terminal region (ARP42423_P050)
Data Sheet
Product Number ARP42423_P050
Product Page
Product Name COBLL1 antibody - N-terminal region (ARP42423_P050)
Size 100 ul
Gene Symbol COBLL1
Alias Symbols KIAA0977, COBLR1
Protein Size (# AA) 1166 amino acids
Molecular Weight 128kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 22837
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name COBL-like 1
Description This is a rabbit polyclonal antibody against COBLL1. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
Target Reference Carroll,E.A., (2003) Dev. Biol. 262 (1), 16-31
Description of Target The function remains known.
Protein Interactions NRD1; PACSIN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Additional Information IHC Information: HepG2 cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 8%.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-COBLL1 (ARP42423_P050) antibody is Catalog # AAP42423 (Previous Catalog # AAPP11560)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COBLL1
Complete computational species homology data Anti-COBLL1 (ARP42423_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COBLL1.
Swissprot Id A6NMZ3
Protein Name Cordon-bleu protein-like 1
Sample Type Confirmation

COBLL1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_055715
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COBLL1.
Nucleotide Accession # NM_014900
Replacement Item This antibody may replace item sc-132238 from Santa Cruz Biotechnology.
Conjugation Options

ARP42423_P050-FITC Conjugated

ARP42423_P050-HRP Conjugated

ARP42423_P050-Biotin Conjugated

CB Replacement sc-132238; sc-142449; sc-94776
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human kidney
Human kidney
Image 2
Human HepG2
WB Suggested Anti-COBLL1 Antibody Titration: 0.5ug/ml
Positive Control: HepG2 cell lysate

COBLL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |