MLH3 Antibody - middle region (ARP42403_P050)

• Product Number: ARP42403_P050
• Name: MLH3 Antibody - middle region (ARP42403_P050)
• Protein Size (# AA): 1429 amino acids
• Molecular Weight: 161kDa
• NCBI Gene Id: 27030
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: MutL homolog 3 (E. coli)
• Alias Symbols: HNPCC7
• Peptide Sequence: Synthetic peptide located within the following region: SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Koessler,T., (er) Gut (2008) In press
• Description of Target: This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. MLH3 functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. The protein encoded by this gene functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
• Protein Interactions: MLH1; MYC; FAN1; AR; MLH3; MSH4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MLH3 (ARP42403_P050) antibody is Catalog # AAP42403 (Previous Catalog # AAPP26404)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MLH3
• Uniprot ID: Q2M1Z1
• Protein Name: MutL homolog 3 (E. coli) EMBL AAI12168.1
• Protein Accession #: NP_055196
• Purification: Affinity Purified
• Nucleotide Accession #: NM_014381
• Tested Species Reactivity: Human
• Gene Symbol: MLH3
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human 293T
  
  WB Suggested Anti-MLH3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: 293T cell lysate