CEMIP2 Antibody - middle region (ARP42382_P050)

Data Sheet
 
Product Number ARP42382_P050
Product Page www.avivasysbio.com/cemip2-antibody-middle-region-arp42382-p050.html
Name CEMIP2 Antibody - middle region (ARP42382_P050)
Protein Size (# AA) 1383 amino acids
Molecular Weight 154 kDa
NCBI Gene Id 23670
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name cell migration inducing hyaluronidase 2
Alias Symbols TMEM2
Peptide Sequence Synthetic peptide located within the following region: MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Scott,D.A., Gene 246 (1-2), 265-274 (2000)
Description of Target This gene encodes a type II transmembrane protein that belongs to the interferon-induced transmembrane (IFITM) protein superfamily. The encoded protein functions as a cell surface hyaluronidase that cleaves extracellular high molecular weight hyaluronan into intermediate size fragments before internalization and degradation in the lysosome. It also has an interferon-mediated antiviral function in humans through activation of the JAK STAT signaling pathway. The activation of this gene by transcription factor SOX4 in breast cancer cells has been shown to mediate the pathological effects of SOX4 on cancer progression. Naturally occurring mutations in this gene are associated with autosomal recessive non-syndromic hearing loss.
Protein Interactions FBXO6; UBC; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-CEMIP2 (ARP42382_P050) antibody
Blocking Peptide For anti-CEMIP2 (ARP42382_P050) antibody is Catalog # AAP42382 (Previous Catalog # AAPP24734)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TMEM2
Uniprot ID Q9UHN6
Protein Name cell surface hyaluronidase
Publications

TMEM2 inhibits hepatitis B virus infection in HepG2 and HepG2.2.15 cells by activating the JAK-STAT signaling pathway. Cell Death Dis. 7, e2239 (2016). 27253403

Protein Accession # NP_037522
Purification Affinity Purified
Nucleotide Accession # NM_013390
Tested Species Reactivity Human
Gene Symbol CEMIP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Isoforms present from ~41 kDa to ~24 kDa.
Image 2
Human PANC1
WB Suggested Anti-TMEM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com