Product Number |
ARP42382_P050 |
Product Page |
www.avivasysbio.com/cemip2-antibody-middle-region-arp42382-p050.html |
Name |
CEMIP2 Antibody - middle region (ARP42382_P050) |
Protein Size (# AA) |
1383 amino acids |
Molecular Weight |
154 kDa |
NCBI Gene Id |
23670 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
cell migration inducing hyaluronidase 2 |
Alias Symbols |
TMEM2 |
Peptide Sequence |
Synthetic peptide located within the following region: MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scott,D.A., Gene 246 (1-2), 265-274 (2000) |
Description of Target |
This gene encodes a type II transmembrane protein that belongs to the interferon-induced transmembrane (IFITM) protein superfamily. The encoded protein functions as a cell surface hyaluronidase that cleaves extracellular high molecular weight hyaluronan into intermediate size fragments before internalization and degradation in the lysosome. It also has an interferon-mediated antiviral function in humans through activation of the JAK STAT signaling pathway. The activation of this gene by transcription factor SOX4 in breast cancer cells has been shown to mediate the pathological effects of SOX4 on cancer progression. Naturally occurring mutations in this gene are associated with autosomal recessive non-syndromic hearing loss. |
Protein Interactions |
FBXO6; UBC; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-CEMIP2 (ARP42382_P050) antibody |
Blocking Peptide |
For anti-CEMIP2 (ARP42382_P050) antibody is Catalog # AAP42382 (Previous Catalog # AAPP24734) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TMEM2 |
Uniprot ID |
Q9UHN6 |
Protein Name |
cell surface hyaluronidase |
Publications |
TMEM2 inhibits hepatitis B virus infection in HepG2 and HepG2.2.15 cells by activating the JAK-STAT signaling pathway. Cell Death Dis. 7, e2239 (2016). 27253403 |
Protein Accession # |
NP_037522 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_013390 |
Tested Species Reactivity |
Human |
Gene Symbol |
CEMIP2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Isoforms present from ~41 kDa to ~24 kDa.
|
|
Image 2 | Human PANC1
| WB Suggested Anti-TMEM2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: PANC1 cell lysate |
|