| Product Number |
ARP42381_P050 |
| Product Page |
www.avivasysbio.com/cemip2-antibody-n-terminal-region-arp42381-p050.html |
| Name |
CEMIP2 Antibody - N-terminal region (ARP42381_P050) |
| Protein Size (# AA) |
1383 amino acids |
| Molecular Weight |
154kDa |
| NCBI Gene Id |
83921 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cell migration inducing hyaluronidase 2 |
| Alias Symbols |
Tmem2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CEMIP2 (ARP42381_P050) antibody |
| Blocking Peptide |
For anti-CEMIP2 (ARP42381_P050) antibody is Catalog # AAP42381 (Previous Catalog # AAPP24733) |
| Uniprot ID |
Q5FWI3 |
| Protein Name |
cell surface hyaluronidase; transmembrane protein 2 |
| Publications |
Zhao, Q. et al. Rare inborn errors associated with chronic hepatitis B virus infection. Hepatology 56, 1661-70 (2012). 22610944 |
| Protein Accession # |
NP_001028931 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033759 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
CEMIP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 85%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Tmem2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
