ITGB1BP2 Antibody - N-terminal region (ARP42358_T100)

Data Sheet
 
Product Number ARP42358_T100
Product Page www.avivasysbio.com/itgb1bp2-antibody-n-terminal-region-arp42358-t100.html
Name ITGB1BP2 Antibody - N-terminal region (ARP42358_T100)
Protein Size (# AA) 347 amino acids
Molecular Weight 38kDa
NCBI Gene Id 26548
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Integrin beta 1 binding protein (melusin) 2
Alias Symbols CHORDC3, ITGB1BP, MELUSIN, MSTP015
Peptide Sequence Synthetic peptide located within the following region: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Goldberg,G.I., (2003) Nat. Med. 9 (1), 19-20
Description of Target ITGB1BP2 may play a role during maturation and/or organization of muscles cells.
Protein Interactions SRP14; RARG; RARB; RARA; PPP1R7; PLOD2; PDCD2L; XPO5; MORF4L2; PIP5K1A; ITGB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ITGB1BP2 (ARP42358_T100) antibody
Blocking Peptide For anti-ITGB1BP2 (ARP42358_T100) antibody is Catalog # AAP42358 (Previous Catalog # AAPS12601)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ITGB1BP2
Uniprot ID Q9UKP3
Protein Name Integrin beta-1-binding protein 2
Protein Accession # NP_036410
Purification Protein A purified
Nucleotide Accession # NM_012278
Tested Species Reactivity Human
Gene Symbol ITGB1BP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human heart
WB Suggested Anti-ITGB1BP2 Antibody Titration: 2.5ug/ml
Positive Control: Human heart
Image 2
Human Muscle
Rabbit Anti-ITGB1BP2 Antibody
Catalog Number: ARP42358
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com