Product Number |
ARP42354_P050 |
Product Page |
www.avivasysbio.com/gpr161-antibody-middle-region-arp42354-p050.html |
Name |
GPR161 Antibody - middle region (ARP42354_P050) |
Protein Size (# AA) |
407 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
23432 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
G protein-coupled receptor 161 |
Alias Symbols |
RE2 |
Peptide Sequence |
Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Small,K.M., FEBS Lett. 516 (1-3), 253-256 (2002) |
Description of Target |
GPR161 is Orphan receptor. |
Protein Interactions |
PRKACA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GPR161 (ARP42354_P050) antibody |
Blocking Peptide |
For anti-GPR161 (ARP42354_P050) antibody is Catalog # AAP42354 (Previous Catalog # AAPP24709) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GPR161 |
Uniprot ID |
Q8N6U8 |
Protein Accession # |
NP_031395 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007369 |
Tested Species Reactivity |
Human |
Gene Symbol |
GPR161 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-GPR161 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Human muscle
| Rabbit Anti-GPR161 Antibody Catalog Number: ARP42354 Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
|