GPR161 Antibody - middle region (ARP42354_P050)

Data Sheet
 
Product Number ARP42354_P050
Product Page www.avivasysbio.com/gpr161-antibody-middle-region-arp42354-p050.html
Name GPR161 Antibody - middle region (ARP42354_P050)
Protein Size (# AA) 407 amino acids
Molecular Weight 45kDa
NCBI Gene Id 23432
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name G protein-coupled receptor 161
Alias Symbols RE2
Peptide Sequence Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Small,K.M., FEBS Lett. 516 (1-3), 253-256 (2002)
Description of Target GPR161 is Orphan receptor.
Protein Interactions PRKACA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GPR161 (ARP42354_P050) antibody
Blocking Peptide For anti-GPR161 (ARP42354_P050) antibody is Catalog # AAP42354 (Previous Catalog # AAPP24709)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GPR161
Uniprot ID Q8N6U8
Protein Accession # NP_031395
Purification Affinity Purified
Nucleotide Accession # NM_007369
Tested Species Reactivity Human
Gene Symbol GPR161
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-GPR161 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human muscle
Rabbit Anti-GPR161 Antibody
Catalog Number: ARP42354
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com