| Product Number |
ARP42353_T100 |
| Product Page |
www.avivasysbio.com/gpr161-antibody-n-terminal-region-arp42353-t100.html |
| Name |
GPR161 Antibody - N-terminal region (ARP42353_T100) |
| Protein Size (# AA) |
529 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
23432 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
G protein-coupled receptor 161 |
| Alias Symbols |
RE2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Small,K.M., FEBS Lett. 516 (1-3), 253-256 (2002) |
| Description of Target |
GPR161 is orphan receptor. |
| Protein Interactions |
PRKACA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-GPR161 (ARP42353_T100) antibody |
| Blocking Peptide |
For anti-GPR161 (ARP42353_T100) antibody is Catalog # AAP42353 (Previous Catalog # AAPP24708) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GPR161 |
| Uniprot ID |
Q8N6U8 |
| Protein Name |
G-protein coupled receptor 161 |
| Protein Accession # |
NP_722561 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_153832 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GPR161 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 93%; Rat: 86% |
| Image 1 | Human Kidney
 | Rabbit Anti-GPR161 Antibody
Catalog Number: ARP42353
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The immunizing peptide sequence is present in isoforms of 61 kDa, 60 kDa, 59 kDa and 45 kDa. Protein may be modified by phosphorylation and/or glycosylation.
|
|
