ZNF19 Antibody - C-terminal region (ARP42332_T100)

• Product Number: ARP42332_T100
• Name: ZNF19 Antibody - C-terminal region (ARP42332_T100)
• Protein Size (# AA): 458 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 7567
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Zinc finger protein 19
• Alias Symbols: KOX12
• Peptide Sequence: Synthetic peptide located within the following region: HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65
• Description of Target: ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF19 (ARP42332_T100) antibody is Catalog # AAP42332 (Previous Catalog # AAPS12501)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF19
• Uniprot ID: P17023
• Protein Name: Zinc finger protein 19
• Protein Accession #: NP_008892
• Purification: Protein A purified
• Nucleotide Accession #: NM_006961
• Tested Species Reactivity: Human
• Gene Symbol: ZNF19
• Predicted Species Reactivity: Human, Yeast
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Yeast: 90%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF19 Antibody Titration: 5.0ug/ml
  Positive Control: Jurkat cell lysate