PSG1 Antibody - C-terminal region (ARP42326_T100)

• Product Number: ARP42326_T100
• Name: PSG1 Antibody - C-terminal region (ARP42326_T100)
• Protein Size (# AA): 426 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 5669
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Pregnancy specific beta-1-glycoprotein 1
• Alias Symbols: SP1, B1G1, PBG1, CD66f, PSBG1, PSG95, PSGGA, DHFRP2, PSBG-1, PSGIIA, FL-NCA-1/2, PS-beta-C/D, PS-beta-G-1
• Peptide Sequence: Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126
• Description of Target: The function remains unknown.
• Protein Interactions: OGT; UTP14A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PSG1 (ARP42326_T100) antibody is Catalog # AAP42326 (Previous Catalog # AAPS12408)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSG1
• Uniprot ID: Q6ICR4
• Protein Name: Pregnancy-specific beta-1-glycoprotein 1
• Sample Type Confirmation:

  PSG1 is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

• Protein Accession #: NP_008836
• Purification: Protein A purified
• Nucleotide Accession #: NM_006905
• Tested Species Reactivity: Human
• Gene Symbol: PSG1
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human NCI-H226
  
  WB Suggested Anti-PSG1 Antibody Titration: 2.5ug/ml
  Positive Control: NCI-H226 cell lysate.PSG1 is strongly supported by BioGPS gene expression data to be expressed in Human NCI-H226 cells